DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and zgc:153968

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:279 Identity:84/279 - (30%)
Similarity:125/279 - (44%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAH 208
            |..|.|...||...::.||..||......:||.|.:.|....|    ..|.|:||||.:||:||.
Zfish    18 SGSLCQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGG----LLCGGTLINREWVLSAAQ 78

  Fly   209 CLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDI 273
            |    .::...:.:.|.||...|.            .|.|......:|..|.:| :.|:|: :||
Zfish    79 C----FQKLTASNLVVHLGHLSTG------------DPNVIHNPASQIINHPKY-DSATNK-NDI 125

  Fly   274 GLIRMERNVRYSDNIQPICLP---SSVGLESRQSGQQFTVAGWG--RTLKMARSAVKQKVTVNYV 333
            .|:::...|.::|.|:|:||.   ||:|     .|....:.|||  .|.........|:|.:..|
Zfish   126 ALLKLSTPVSFTDYIKPVCLTASGSSLG-----KGAVSWITGWGSINTGGTQFPTTLQEVKIPVV 185

  Fly   334 DPAKCRQRFSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKD 397
            ....|:..:..:   :....:||| .:..|..|.||.||||:....|.|:..||.|||..|....
Zfish   186 SNGDCKSAYGSL---ITDGMICAGPNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPK 247

  Fly   398 WPGVYTNVAAYDIWIRQNV 416
            .|||:|.|:.|:.||:..:
Zfish   248 NPGVFTRVSEYESWIKSQI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 77/256 (30%)
Tryp_SPc 162..415 CDD:238113 78/258 (30%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 77/256 (30%)
Tryp_SPc 36..265 CDD:238113 78/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.