DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG18754

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:439 Identity:119/439 - (27%)
Similarity:172/439 - (39%) Gaps:129/439 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFAAVFL----------CILIAHEAKAQSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQ 56
            ||:..|.|          |:.:   :..|.|.:|..          :..|..|.::|:...:|..
  Fly     6 KVYILVLLQAIFFNQLAECVRL---SSCQKDEKCTR----------LVSCSPLMNILRPRGMTQA 57

  Fly    57 EKSFIKSSACGRGSN-----NQPYVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPR 116
            ||.......||...|     :..||||                |:.|                  
  Fly    58 EKDVFAHRQCGLDPNGHELLHMVYVCC----------------PELG------------------ 88

  Fly   117 QERRPWSFGNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEY 181
                                        .:||...:||......|....::.::||:||||||.|
  Fly    89 ----------------------------DVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLY 125

  Fly   182 RRRSGNGLSTACAGSLINRRYVLTAAHC-LTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCS 245
            ..|.          |||  ||||||||| :.|.:.:....|.||||||..|    ||......|.
  Fly   126 ENRL----------SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT----DCITSESRCP 174

  Fly   246 PEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTV 310
            .....:|  :..||:.::.......:||.|:|::..|||:..||||||   :..|.........:
  Fly   175 HLDVEVG--QTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL---LDAEFPLQDLNLQI 234

  Fly   311 AGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMR 375
            :||..| |.:::.:..  ||...:||.|..|:...:   ..:|:|||||.:.|:|.|.||.|:|.
  Fly   235 SGWDPT-KSSQTLITS--TVKERNPADCLNRYPSFR---SASQVCAGGQRKGDTCAGISGSPVMG 293

  Fly   376 FR----DESWVLEGIVSFG----YKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ..    ||...|.||.|:|    |..|:   |||||.:..:..||:.|:
  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGI---PGVYTKIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 12/57 (21%)
Tryp_SPc 161..412 CDD:214473 89/259 (34%)
Tryp_SPc 162..415 CDD:238113 90/261 (34%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/58 (21%)
Tryp_SPc 108..338 CDD:238113 90/259 (35%)
Tryp_SPc 108..335 CDD:214473 88/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.