DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG34458

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:116/276 - (42%) Gaps:63/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGT 220
            |...:||..||.....:||..|.|:...|.      .|.||||:...::|||||..|:...::..
  Fly    26 VAEESRIIGGQFAAPGQFPHQVSLQLNGRH------HCGGSLISDTMIVTAAHCTMGQNPGQMKA 84

  Fly   221 LVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYS 285
            :|...          |...|.|      |.....:..:|.||:.:  :|..|:.||::...|...
  Fly    85 IVGTN----------DLSAGNG------QTFNIAQFIIHPRYNPQ--SQDFDMSLIKLSSPVPMG 131

  Fly   286 DNIQPICLPSSVGLESRQSGQQFT-VAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKV-- 347
            ..:|.|.|..|   :|..:..... ::|:|        |:.|.:.:      ..|.:|:|:::  
  Fly   132 GAVQTIQLADS---DSNYAADTMAMISGFG--------AINQNLQL------PNRLKFAQVQLWS 179

  Fly   348 ----------NLEPTQLCAG---GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWP 399
                      .|....:|||   ||.  .||.|||||||    .....|.|:||:|:.||.|..|
  Fly   180 RDYCNSQNIPGLTDRMVCAGHPSGQV--SSCQGDSGGPL----TVDGKLFGVVSWGFGCGAKGRP 238

  Fly   400 GVYTNVAAYDIWIRQN 415
            .:||.|.|...||:||
  Fly   239 AMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/266 (27%)
Tryp_SPc 162..415 CDD:238113 74/268 (28%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 73/266 (27%)
Tryp_SPc 32..254 CDD:238113 74/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.