DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:281 Identity:84/281 - (29%)
Similarity:128/281 - (45%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CG--GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIE 215
            ||  ...:..||..|.:.....:||||.|:.|      ....|.|||||.::|||||||:   ::
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVSLQGR------YGHFCGGSLINNQWVLTAAHCI---VD 80

  Fly   216 REVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLG--FEEIRVHERYSEKASNQVHDIGLIRM 278
            :...::: |.||:..:..|            :|..:.  ...|..|..||....:  :||.|:::
Zfish    81 QTPSSII-VYLGKWRSYVA------------DVNSISRTIRHIIPHPSYSNITKD--NDIALLQL 130

  Fly   279 ERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFS 343
            ...|:|:|.|:||||........|  |....|||||....:....::.:.||:...|.....:.:
Zfish   131 TSTVQYTDYIKPICLADENSNFPR--GTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEA 193

  Fly   344 QIKV------------NLEPTQLCAGGQ-FRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGL 395
            ::||            .:.|..:|||.: ..|.:..||||||||. :...||..|::|.||.|..
Zfish   194 ELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPLMT-KCSVWVQAGVLSHGYGCAQ 257

  Fly   396 KDWPGVYTNVAAYDIWIRQNV 416
            .:.|.|:..|:.|..||..||
Zfish   258 PNLPEVFIRVSEYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 78/265 (29%)
Tryp_SPc 162..415 CDD:238113 79/267 (30%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 77/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.