DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and zgc:112038

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:272 Identity:85/272 - (31%)
Similarity:128/272 - (47%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL----TGR 213
            ||...:.|. ..|.|.....:||...:  .|.|..  ...|.|||||:.:||:||||.    |..
Zfish    27 CGQAPLNNN-NGGDDAVAGSWPWQASI--HRISPE--DHICGGSLINKDWVLSAAHCFMITATAN 86

  Fly   214 IEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRM 278
            |:..:|.....                 ||...|:.|. ..:|.:|..||....|  :||.|:|:
Zfish    87 IKIFLGRQFQT-----------------GSNPNEISRT-LTQIVIHPDYSTTTQN--NDIALLRL 131

  Fly   279 ERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWG--RTLKMARSAVKQKVTVNYVDPAKCRQR 341
            ..:|.::|.|:|:||.|:..:.:  .|.:..:.||.  |:..:..:.|.|:|.:..|...:|...
Zfish   132 SSSVTFTDYIRPVCLASADSVFA--GGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNAD 194

  Fly   342 FSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNV 405
            :..|   :....:||| .:..||:|.||||||::......|:..||||||.:|||..:||:||.|
Zfish   195 YKGI---ITDNMICAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRV 256

  Fly   406 AAYDIWIRQNVR 417
            :.|..||...:|
Zfish   257 SQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 79/257 (31%)
Tryp_SPc 162..415 CDD:238113 81/259 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 79/254 (31%)
Tryp_SPc 37..263 CDD:238113 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.