DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and prss60.2

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:274 Identity:88/274 - (32%)
Similarity:132/274 - (48%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLT 211
            |.|...||...:.:||..|.:.....:||.|.|:..|..|:    .|.||||:..:||||||||.
Zfish    19 LSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGH----FCGGSLISSEWVLTAAHCLP 79

  Fly   212 GRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLI 276
            |..|   .:|| |.||.. |:..|:        :.|..| ...:|.||..|:...::  :||.|:
Zfish    80 GVSE---SSLV-VYLGRR-TQQGVN--------THETSR-NVAKIIVHSSYNSNTND--NDIALL 128

  Fly   277 RMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRT---LKMARSAVKQKVTVNYVDPAKC 338
            |:...|.::|.|:|:||.:...:.|  :|....:.|||..   :.:....:.|:..:..|...:|
Zfish   129 RLSSAVTFNDYIRPVCLAAQNSVYS--AGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC 191

  Fly   339 RQRFSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVY 402
            ..:.....|.  ...:||| .:..||:|.||||||::......|:..||.|:||.|...:.||||
Zfish   192 NAQLGSGTVT--NNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGVY 254

  Fly   403 TNVAAYDIWIRQNV 416
            |.|:.|..||...:
Zfish   255 TRVSQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 82/254 (32%)
Tryp_SPc 162..415 CDD:238113 83/256 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 82/254 (32%)
Tryp_SPc 34..267 CDD:238113 83/256 (32%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.