DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and grass

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:413 Identity:118/413 - (28%)
Similarity:183/413 - (44%) Gaps:85/413 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AKAQSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQE-----KSFIKSSACGRGSNNQPYV 76
            |:|.....|..|:...|.|:..:.|:|:...|..|....|:     .|:::.:.||. .|...:.
  Fly    24 ARADYADDCTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPADYASYLQKALCGE-FNGVRHF 87

  Fly    77 CCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTS 141
            ||..    ..||...:....:          :.::|                             
  Fly    88 CCPS----ANIQHNSKVMSLF----------KDENF----------------------------- 109

  Fly   142 DGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTA 206
                      .||.. :..|:.:|.:..::..|||.||.|::...:..  .|.|::|:.||:|||
  Fly   110 ----------DCGNF-LSQRVSNGYEVKLSSRPWMALLRYQQFGESRF--LCGGAMISERYILTA 161

  Fly   207 AHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGG--GSCSPEVQRLGFEEIRVHERYSEKASNQ 269
            |||:.| ::.:   |..:|||||...|..||...|  ..|:|.|..:|.|:..:||:|.  |.:.
  Fly   162 AHCVHG-LQND---LYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYD--ARHI 220

  Fly   270 VHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQ---FTVAGWGRTLKMARSAVKQKVTVN 331
            :|||.|:::.|:|.:..:|:|||||  :..|.::..:|   :.|.|||.|...:.|.|..:..|.
  Fly   221 MHDIALLKLNRSVPFQKHIKPICLP--ITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVP 283

  Fly   332 YVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLM---RFRDE---SWVLEGIVSFG 390
            ....:.|.|.:.:.   :..:|||.||...:|||.|||||||.   ::..|   ..|..||||.|
  Fly   284 LQPRSACSQAYRRA---VPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQG 345

  Fly   391 -YKCGLKDWPGVYTNVAAYDIWI 412
             ..||....||:||||..|..||
  Fly   346 VVTCGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 13/57 (23%)
Tryp_SPc 161..412 CDD:214473 94/262 (36%)
Tryp_SPc 162..415 CDD:238113 95/263 (36%)
grassNP_651543.1 CLIP 32..90 CDD:197829 14/58 (24%)
Tryp_SPc 121..371 CDD:238113 95/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.