DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG11836

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:314 Identity:101/314 - (32%)
Similarity:152/314 - (48%) Gaps:49/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GNQPATSR----TPFRKSS----------TSD------GSSLLPQPPSCGGVGIRNRIYDGQDTD 169
            |:...||:    |.||.||          |.|      .|||......||......||..|:.|.
  Fly    40 GHNKRTSKFLFDTIFRISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTG 104

  Fly   170 VNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTA 234
            ||::|||..:.|..:      ..|.|||:.:.|||:||||    :::...:.:.|..|:||....
  Fly   105 VNQYPWMARIVYDGK------FHCGGSLLTKDYVLSAAHC----VKKLRKSKIRVIFGDHDQEIT 159

  Fly   235 VDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGL 299
                    |.|..:||.....|: |:.:.....|  :||.|:|:.:.:.:|..|:|||||.   .
  Fly   160 --------SESQAIQRAVTAVIK-HKSFDPDTYN--NDIALLRLRKPISFSKIIKPICLPR---Y 210

  Fly   300 ESRQSGQQFTVAGWGRTLKMAR-SAVKQKVTVNYVDPAKCR-QRFSQIKVNLEPTQLCAGGQFRK 362
            ....:|:..||.|||||.:... .::..:|.|..:...:|| ||:...::.  .:.||| |:...
  Fly   211 NYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRIT--SSMLCA-GRPSM 272

  Fly   363 DSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |||.|||||||:......:.:.||||:|..||.:.:||||:.|:.:..||:.|:
  Fly   273 DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 83/252 (33%)
Tryp_SPc 162..415 CDD:238113 84/254 (33%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 84/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.