DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and SPE

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:412 Identity:148/412 - (35%)
Similarity:209/412 - (50%) Gaps:67/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQEKSFIKSSACG-----RGSNNQPYVCCT 79
            |||.|        |.||.|..|..|.::|.....|..::..:..|.||     .|..|:..||| 
  Fly    39 QSDER--------GQCVHITSCPYLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNRILVCC- 94

  Fly    80 QDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTSDGS 144
                                         |||.           .||...:..||..:.:...| 
  Fly    95 -----------------------------PQSM-----------RGNIMDSEPTPSTRDALQQG- 118

  Fly   145 SLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHC 209
            .:||....||.: ..:||:.|.:|.:.||||||||:|::......:..|.|:|:|.||||||.||
  Fly   119 DVLPGNDVCGFL-FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHC 182

  Fly   210 LTGR-IEREVGTLVSVRLGEHDTRTAVDCPP---GGGSCSPEVQRLGFEEIRVHERYSEKASNQV 270
            |..| :::....|.||||||.||||..||..   |...|:|:...:..|:..:||.|:..:.:|.
  Fly   183 LASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQR 247

  Fly   271 HDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDP 335
            :||.|:|::|.|.|:|.::|||||:...:::........|||||.|..|..||:|.|:|||..:.
  Fly   248 NDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNL 312

  Fly   336 AKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLM-----RFRDESWVLEGIVSFGYK-CG 394
            ..|::::|..||.|:.:|:|||||...|:|.||||||||     ..||..:: .|:.|:|.| ||
  Fly   313 TSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYI-AGVTSYGTKPCG 376

  Fly   395 LKDWPGVYTNVAAYDIWIRQNV 416
            ||.||||||...|:..||:|.:
  Fly   377 LKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 14/57 (25%)
Tryp_SPc 161..412 CDD:214473 113/260 (43%)
Tryp_SPc 162..415 CDD:238113 114/262 (44%)
SPENP_651168.1 CLIP 42..94 CDD:314844 15/59 (25%)
Tryp_SPc 135..397 CDD:238113 114/262 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25969
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.