DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG16710

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:442 Identity:130/442 - (29%)
Similarity:181/442 - (40%) Gaps:114/442 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLCILIAHEA----KAQSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQEKSFIKSSACG 67
            |::..|:.|..    .|:|:....|.::.   |:.:..|.:|...||...:|..||:..:...||
  Fly     7 VYISFLVLHTQLLMYLAESEYPPCNLDEK---CISLARCTSLLPFLKPHNMTPAEKAVFEDRYCG 68

  Fly    68 RGSNNQP-----YVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQ 127
            .|...|.     .:||                |:.|                             
  Fly    69 YGPKGQELLDRVLICC----------------PNMG----------------------------- 88

  Fly   128 PATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRS----GNG 188
                             .:||....||.:....||:.|::|..||.|||.|:.|..||    ...
  Fly    89 -----------------HILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNER 136

  Fly   189 LSTACAGSLINRRYVLTAAHCL--TGRIEREVGTLVSVRLGEHDTRTAVDCPP---GGGSCSPEV 248
            |.:.||||||..||||||||||  ||.      .|..||||||:..:..||..   |...|:||.
  Fly   137 LVSRCAGSLITNRYVLTAAHCLRITGL------DLRRVRLGEHNILSNPDCVTHINGREHCAPEH 195

  Fly   249 QRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICL--------PSSVGLESRQSG 305
            ..:..:....|..|........:||.|:|::..|||:..|:|||:        ||.       |.
  Fly   196 LEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSF-------SN 253

  Fly   306 QQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLE-PTQLCAGGQFRKDSCDGDS 369
            .:..:||||.:.|...|.|..:..||..:..:|  ..|:..:.|: .|.:|||.....|:|.|||
  Fly   254 HKLQIAGWGLSHKQGYSNVLLQAYVNGRNADEC--SLSEPSLGLDKETHICAGNLGGNDTCKGDS 316

  Fly   370 GGPLMRFR---DESWV-LEGIVSFGY-KCGLKDWPGVYTNVAAYDIWIRQNV 416
            |||||...   ||.:| |.||.|:|| :||.  .|..||..:.:..||..|:
  Fly   317 GGPLMAIMERGDEEFVYLAGITSYGYSQCGY--GPAAYTKTSKFVEWILWNM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 13/57 (23%)
Tryp_SPc 161..412 CDD:214473 101/273 (37%)
Tryp_SPc 162..415 CDD:238113 102/275 (37%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/51 (24%)
Tryp_SPc 105..362 CDD:214473 101/273 (37%)
Tryp_SPc 106..362 CDD:238113 100/272 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.