DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG7142

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:323 Identity:89/323 - (27%)
Similarity:137/323 - (42%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SSTSDGSSLLPQPPSCGG---VG--------------IRNRI---------------YDGQDTDV 170
            ||.|.||..||....|||   .|              :.|||               ...::...
  Fly    24 SSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATP 88

  Fly   171 NEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAV 235
            :..|::|.:: ......||...|||::||..::|||||||:.....|...:|:   |.||..   
  Fly    89 HSAPYVVSIQ-MMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVA---GSHDIH--- 146

  Fly   236 DCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLE 300
              ...|.:.:.:::.:.: .:| ||.|  ......:||.||..:..:.:...:||..||.    :
  Fly   147 --DQKGEASNIQMRHIDY-YVR-HELY--LGGVNPYDIALIYTKEPLVFDTYVQPATLPE----Q 201

  Fly   301 SRQSGQQFTVAGWGRTLKMARSAVK------QKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQ 359
            ..|.....|:.|||   .::.:||.      |:..:..:|...|.|..::..:.|..|.||.|..
  Fly   202 DAQPEGYGTLYGWG---NVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPL 263

  Fly   360 FRKDS-CDGDSGGPLMR------FRDESWVLEGIVSFG-YKCGLKDWPGVYTNVAAYDIWIRQ 414
            ....| |..||||||::      |...:.|: ||||:| ..||.|:.|.|:..|:|:..||.|
  Fly   264 TGGVSICTADSGGPLIQQCCEEHFEQANIVI-GIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 74/279 (27%)
Tryp_SPc 162..415 CDD:238113 76/282 (27%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/263 (29%)
Tryp_SPc 84..323 CDD:214473 72/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.