DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG14892

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:444 Identity:104/444 - (23%)
Similarity:155/444 - (34%) Gaps:153/444 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTSDGSSLLPQPPS-------CGGVGIRN--R 161
            :.||:|.:..|.:.|..|........:.|...::|.....||...||       ||....|.  |
  Fly    16 QSRPKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPARRGPR 80

  Fly   162 IYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRI-EREVGTLVSVR 225
            |..|..|:..:|||...||....|...|...|...||::.::|:||||:...: ...:..|.:|.
  Fly    81 IIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVV 145

  Fly   226 LGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMER--NVRYSDNI 288
            |||||.    |...|      ..||:..|:|.:|.||    .|..||:.|:::.:  ::..:.||
  Fly   146 LGEHDR----DVESG------NEQRIPVEKIVMHHRY----HNFKHDVVLMKLSKPADLTRASNI 196

  Fly   289 QPICLPSSVGLESRQSGQQFTVA------------------------------------------ 311
            :.||||..:. ||....|..||:                                          
  Fly   197 RRICLPFLLA-ESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAP 260

  Fly   312 ----------------------------------------------------------------- 311
                                                                             
  Fly   261 SMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAF 325

  Fly   312 ------GWGR---TLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAG---GQFRKDS 364
                  |||:   :..::...:|.:|.::  ...:||..:... ||:....||||   |:  ..:
  Fly   326 VDCVATGWGKANISGDLSNQLLKTQVPLH--QNGRCRDAYGSF-VNIHGGHLCAGKLNGE--GGT 385

  Fly   365 CDGDSGGPLM--RFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |.|||||||.  ..||..|:|.|:.|||..|.|:.:|.|||..:.|..||...:
  Fly   386 CVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 87/374 (23%)
Tryp_SPc 162..415 CDD:238113 88/376 (23%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 87/374 (23%)
Tryp_SPc 81..438 CDD:238113 88/376 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.