DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG9649

DIOPT Version :10

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:30 Identity:10/30 - (33%)
Similarity:14/30 - (46%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YSFTGDDGQVYTVNYVADENGFQPEGAHLP 103
            |:|...:|.:.|:||.. .||..|.....|
  Fly   198 YTFPKPEGAMQTLNYNV-HNGLGPSTLSSP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:463440 2/3 (67%)
Tryp_SPc 162..415 CDD:238113
CG9649NP_650343.1 GD_N 29..132 CDD:464985
Tryp_SPc 257..498 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.