| Sequence 1: | NP_651784.2 | Gene: | CG9733 / 43601 | FlyBaseID: | FBgn0039759 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650343.1 | Gene: | CG9649 / 41727 | FlyBaseID: | FBgn0038211 | Length: | 504 | Species: | Drosophila melanogaster |
| Alignment Length: | 30 | Identity: | 10/30 - (33%) |
|---|---|---|---|
| Similarity: | 14/30 - (46%) | Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 YSFTGDDGQVYTVNYVADENGFQPEGAHLP 103 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9733 | NP_651784.2 | CLIP | 25..78 | CDD:463440 | 2/3 (67%) |
| Tryp_SPc | 162..415 | CDD:238113 | |||
| CG9649 | NP_650343.1 | GD_N | 29..132 | CDD:464985 | |
| Tryp_SPc | 257..498 | CDD:238113 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||