DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG9372

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:397 Identity:115/397 - (28%)
Similarity:173/397 - (43%) Gaps:87/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SNNQPYVCCTQDTGYVRIQRQDR------------TFPDYGA----FGGDWEEERPQSFVF---P 115
            |.||.|...|.:...|....|.|            ...||||    .|   |..|.:..::   |
  Fly    45 SENQVYENRTGENRVVSFLSQHRLNKRQAPTSQLLENKDYGACSTPLG---ESGRCRHIIYCRMP 106

  Fly   116 RQERRPW------------SFG----NQPATSRTPFRKSSTSDGSS-LLPQPPSCGGVGIRN--- 160
            ..:...|            |.|    :|..::|...:..:::||.. .:...|...|.||.:   
  Fly   107 ELKNDVWRLVSQLCIIEKSSIGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQF 171

  Fly   161 -RIYDGQDTDVNEFPWM-VLLEYRRRSGNGLSTA-CAGSLINRRYVLTAAHCLTGRIEREVGTLV 222
             |:..|:..:.:|:||| .||:      .||... |.|.||..|:|||||||:..:.:.:    :
  Fly   172 PRLTGGRPAEPDEWPWMAALLQ------EGLPFVWCGGVLITDRHVLTAAHCIYKKNKED----I 226

  Fly   223 SVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFE--EIRVHERYSEKASNQVHDIGLIRMERNVRYS 285
            .|||||::|...           .|.:...|.  .:.:|..|:.:  |..:||.::|::|...::
  Fly   227 FVRLGEYNTHML-----------NETRARDFRIANMVLHIDYNPQ--NYDNDIAIVRIDRATIFN 278

  Fly   286 DNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMA--RSAVKQKVTVNYVDPAKCRQRFSQIKVN 348
            ..|.|:|:|.   :....|.:...|.||| |.|..  .|.:..:|.:.....:.||..|.|   :
  Fly   279 TYIWPVCMPP---VNEDWSDRNAIVTGWG-TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQ---H 336

  Fly   349 LEPTQLCA----GGQFRKDSCDGDSGGPLM-RFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAY 408
            :..|.:||    |||   |||.|||||||: :..::.||..||||:|..||.:..||:||.|..|
  Fly   337 VPDTAMCAGFPEGGQ---DSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRY 398

  Fly   409 DIWIRQN 415
            ..||..|
  Fly   399 LDWILAN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 4/7 (57%)
Tryp_SPc 161..412 CDD:214473 85/261 (33%)
Tryp_SPc 162..415 CDD:238113 86/263 (33%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 7/47 (15%)
Tryp_SPc 173..402 CDD:214473 85/261 (33%)
Tryp_SPc 176..402 CDD:238113 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.