DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG6865

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:305 Identity:100/305 - (32%)
Similarity:151/305 - (49%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SFGNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGN 187
            :|.|||.:.|.|                          :|..|.:.:.||.|:||.|  .||.|:
  Fly    22 AFSNQPCSVRNP--------------------------KIVGGSEAERNEMPYMVSL--MRRGGH 58

  Fly   188 GLSTACAGSLINRRYVLTAAHCLTGRIER--EVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQR 250
                .|.|::|:.|::|||.||:...:::  :...:..| :|.|..|..::   |.|: .|:..|
  Fly    59 ----FCGGTIISERWILTAGHCICNGLQQFMKPAQIQGV-VGLHSIREYLN---GIGN-GPDALR 114

  Fly   251 LGFEEIRVHERYSEKASNQV-HDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQF-TVAGW 313
            :.|:.|..|.:|.   .|.| |||.|:.:.:.:|:|.:|||.|:.|..|..|.:  |:: ||:||
  Fly   115 VDFKNIVPHPQYD---CNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLE--QEYGTVSGW 174

  Fly   314 GRT----LKMARSAVKQKVTVNYVDPAKCRQRFSQI-KVN-LEPTQLCAG---GQFRKDSCDGDS 369
            |.|    .:..||.|.:|.||...:...|.:.:..: |.| :..||||||   ||.  |||..||
  Fly   175 GWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQI--DSCWADS 237

  Fly   370 GGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQ 414
            |||||   .:...|.|:||.|..|.....||:||.|:.|..|:::
  Fly   238 GGPLM---SKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 93/263 (35%)
Tryp_SPc 162..415 CDD:238113 94/266 (35%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 93/262 (35%)
Tryp_SPc 35..280 CDD:238113 94/266 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.