DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG14990

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:295 Identity:80/295 - (27%)
Similarity:128/295 - (43%) Gaps:55/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SLLPQPPS-CG-----GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYV 203
            :|.|.|.. ||     |:....::.....|. .:|||:|.| :.:....|     |||||....|
  Fly    39 NLQPDPNQVCGMSNPNGLVANVKVPKDYSTP-GQFPWVVAL-FSQGKYFG-----AGSLIAPEVV 96

  Fly   204 LTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASN 268
            ||||..:.|:.:.|    :.||.||.:|....:..|   |....|.|     :..|..:|.... 
  Fly    97 LTAASIVVGKTDAE----IVVRAGEWNTGQRSEFLP---SEDRPVAR-----VVQHREFSYLLG- 148

  Fly   269 QVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQF-----TVAGWGRTLKMA-----RSA 323
             .::|.|:.:........:|:.|||||        .|:.|     .|.|||   |:|     .|.
  Fly   149 -ANNIALLFLANPFELKSHIRTICLPS--------QGRSFDQKRCLVTGWG---KVAFNDENYSN 201

  Fly   324 VKQKVTVNYVDPAKCRQRFSQ----IKVNLEPTQLCAGGQFRKDSCDGDSGGPL---MRFRDESW 381
            :::|:.:..::.|:|:.:...    :..:|..:.:||||:.....|.||.|..|   |......:
  Fly   202 IQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRY 266

  Fly   382 VLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ...|||::|..|..::.|.|||||..:..||.:::
  Fly   267 EQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 72/267 (27%)
Tryp_SPc 162..415 CDD:238113 74/269 (28%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 74/264 (28%)
Tryp_SPc 67..297 CDD:214473 72/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.