DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG8738

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:308 Identity:92/308 - (29%)
Similarity:140/308 - (45%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIY--DGQDTDVN---EFPWMVLLEYRRR 184
            |:|....|.|.:::..   ..||   ..||....:...|  ||.:...:   ||||||.|  ...
  Fly   166 GDQIEEGRNPIQRNVK---DFLL---KGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVAL--MDM 222

  Fly   185 SGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQ 249
            .||   ..|.|:||:.:.|||:||.:..|.|..    :.||.|:.|..:..:..|        .|
  Fly   223 EGN---FVCGGTLIHPQLVLTSAHNVFNRSEDS----LLVRAGDWDLNSQTELHP--------YQ 272

  Fly   250 RLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICL--PSSVGLESRQSGQQFTVAG 312
            .....|:..||.::.  ....:||.|:.:||..:.:.:||||||  |.:..:|:..........|
  Fly   273 MRAISELHRHENFNN--LTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATG 335

  Fly   313 WGRTLKMARSA--VKQKVTVNYVDPAKCRQRFSQI----KVNLEPTQLCAGGQFRKDSCDGDSGG 371
            ||.....:|:.  :.:::.:..||...|::.....    :.||.|:..||||...||:|.||.|.
  Fly   336 WGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGS 400

  Fly   372 PL---MRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ||   :..:.:.:.|.|:||:|.:|..||.|..|||||....||.:.|
  Fly   401 PLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 81/266 (30%)
Tryp_SPc 162..415 CDD:238113 83/268 (31%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 80/258 (31%)
Tryp_SPc 207..444 CDD:214473 78/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.