DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and SPH93

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:311 Identity:91/311 - (29%)
Similarity:145/311 - (46%) Gaps:49/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SFGNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRN-RIYDGQDTD---VNEFPWMVLLEYRR 183
            :|||.......|    :|:.|||.| ..||||...... ::.:|...|   ..::||.|.:.:  
  Fly   208 NFGNPTNNGGNP----TTNVGSSEL-LSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFH-- 265

  Fly   184 RSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEV 248
               ||...| .||||....|||.||.:. .||.|    :.||.|:.|.::           ..|:
  Fly   266 ---NGQYLA-GGSLIQPNVVLTVAHRVI-TIETE----LVVRAGDWDLKS-----------DREI 310

  Fly   249 ---QRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTV 310
               ::...|...:||.:..|:.  .:::.|:.:....:.:|:|:.||||:.   ....:|::.||
  Fly   311 FLSEQREVERAVIHEGFDFKSG--ANNLALLFLNSPFKLNDHIRTICLPTP---NKSFAGRRCTV 370

  Fly   311 AGWG--RTLKMARSAVKQKVTVNYVDPAKCRQ--RFSQI--KVNLEPTQLCAGGQFRKDSCDGDS 369
            ||||  |......|.|.:||.:..|:...|.:  |.:::  |..|....:||||:..:|:|.||.
  Fly   371 AGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDG 435

  Fly   370 GGPLMRF--RDESWVLE--GIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |..|...  .:.|.|.|  |||::|..||.:..|.:||.|:.:..||.:.:
  Fly   436 GSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 76/266 (29%)
Tryp_SPc 162..415 CDD:238113 78/268 (29%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 77/261 (30%)
Tryp_SPc 252..482 CDD:214473 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.