DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG4793

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:306 Identity:89/306 - (29%)
Similarity:130/306 - (42%) Gaps:80/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PQPPSCGGV---GIRNRIYDGQD-TDVNEFPWMV-LLEYRRRSGNGLSTACAGSLINRRYVLTAA 207
            |.|..||.|   |:...|.:.:| ....|.|||| ||:.|.|...|     .||||.|..|||::
  Fly    81 PLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG-----GGSLITRDVVLTSS 140

  Fly   208 HCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEI---RVHE--------R 261
               |..:|.....|: ||.||.|                      ||.|   |.||        |
  Fly   141 ---TKTLEVPEKYLI-VRAGEWD----------------------FESITEERAHEDVAIRKIVR 179

  Fly   262 YSE-KASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQF-----TVAGWGRTLKMA 320
            ::. ...|..::..|:.:.|.::...:|..||||        ...:.|     .|:|||:...:.
  Fly   180 HTNLSVENGANNAALLFLARPLKLDHHIGLICLP--------PPNRNFIHNRCIVSGWGKKTALD 236

  Fly   321 RS--AVKQKVTVNYVDPAKCRQRFSQIKVN--------LEPTQLCAGGQFRKDSCDGDSGGPL-- 373
            .|  .:.:|:.:..||.:.|     |.|:.        |:.:.:||||:..||:|.||.|.||  
  Fly   237 NSYMNILKKIELPLVDRSVC-----QTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLAC 296

  Fly   374 -MRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNVRA 418
             ::.....:.|.|||:||:.|| ...|..||:|:....||...::|
  Fly   297 PLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWIDNCIQA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 80/282 (28%)
Tryp_SPc 162..415 CDD:238113 82/284 (29%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 80/276 (29%)
Tryp_SPc 105..335 CDD:214473 78/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.