DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and prss60.3

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:280 Identity:85/280 - (30%)
Similarity:127/280 - (45%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLT 211
            |.|...||...:..||..|.:.....:||.|.|...:..|:    .|.||||:..:||||||||:
Zfish    21 LSQLNVCGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGH----FCGGSLISSEWVLTAAHCLS 81

  Fly   212 GRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIR------VHERYSEKASNQV 270
            |..|    |.:.|.||.. |:..::.               :|..|      ||..|:...::  
Zfish    82 GVSE----TTLVVYLGRR-TQQGINI---------------YETSRNVAKSFVHSSYNSNTND-- 124

  Fly   271 HDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWG---RTLKMARSAVKQKVTVNY 332
            :||.|:|:...|.:::.|:|:||.:...:.|  :|....:.|||   ..:.:....:.|:..:..
Zfish   125 NDIALLRLSSAVTFTNYIRPVCLAAQNSVYS--AGTSSWITGWGDIQAGVNLPAPGILQETMIPV 187

  Fly   333 VDPAKCRQRFSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLK 396
            |...:|........|.  ...:||| .|..||:|.||||||::......||..||.|:||.|...
Zfish   188 VANDRCNALLGSGTVT--NNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADP 250

  Fly   397 DWPGVYTNVAAYDIWIRQNV 416
            :.|||||.|:.|..||...:
Zfish   251 NSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 79/260 (30%)
Tryp_SPc 162..415 CDD:238113 80/262 (31%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 80/262 (31%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.