DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG18557

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:357 Identity:100/357 - (28%)
Similarity:160/357 - (44%) Gaps:79/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPATS-RTPFRKSSTSDGSS---LLPQPPSC 153
            |..:.||..|...|..||...    :...|   ||.|.| .:|.::|.:...||   ::..|.:|
  Fly    14 TLTETGAPCGLQMECVPQGLC----KTSAW---NQNAISWPSPCQRSESCCHSSQKLVIGAPLNC 71

  Fly   154 G-----GVGIRNRIYDGQDTDV------NEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAA 207
            |     |:|       |...:|      |||||.|.|     ..|.::...||:|:....|:|||
  Fly    72 GKSNPNGLG-------GTVEEVVDQAKPNEFPWTVAL-----MQNLINFFGAGTLVTENIVITAA 124

  Fly   208 HCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIR--------VHERYSE 264
            |.:..:...:.|.:                   ||:.  ::::|..:.|:        .|..:::
  Fly   125 HLMLDKTINDFGII-------------------GGAW--DLKQLAGKTIQWRTATRIVSHPDFNK 168

  Fly   265 KASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMAR--SAVKQK 327
            ...  .::|.||.:|.:......|.|||.|:| |:...:  ::..||||||...:|:  |..::|
  Fly   169 MTG--ANNIALIVLETSFVMKPPIGPICWPTS-GVSFDR--ERCLVAGWGRPDFLAKNYSYKQKK 228

  Fly   328 VTVNYVDPAKC-----RQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLM---RFRDESWVLE 384
            :.:..|..:.|     |..|.| ...|:||.|||||:..:|:|.||.|.|||   ......:.|.
  Fly   229 IDLPIVSRSDCESLLRRTAFVQ-SFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELV 292

  Fly   385 GIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |||:.|:.|||::.|.:|||::....||.:.:
  Fly   293 GIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 77/274 (28%)
Tryp_SPc 162..415 CDD:238113 79/276 (29%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/266 (29%)
Tryp_SPc 90..320 CDD:214473 75/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.