DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG1304

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:293 Identity:81/293 - (27%)
Similarity:135/293 - (46%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL 210
            ||..|.......:..|:..|:|...|:||..|.|   |.:|   |.:|.||:::|.||||||||:
  Fly    16 LLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSL---RNAG---SHSCGGSILSRNYVLTAAHCV 74

  Fly   211 TGR----------IEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEK 265
            |.:          .||     .::|.|.:|..:       ||..   ||   ..|:.|||.|   
  Fly    75 TNQDSNGNSVPIAAER-----FTIRAGSNDRFS-------GGVL---VQ---VAEVIVHEEY--- 118

  Fly   266 ASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTV 330
             .|.::|:.|:|:|..:..|.:||||.||::    ...:.....::||||        :|.:..:
  Fly   119 -GNFLNDVALLRLESPLILSASIQPIDLPTA----DTPADVDVIISGWGR--------IKHQGDL 170

  Fly   331 -NYVDPAKCRQRFSQIK-VNLE----------PTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVL 383
             .|:       :::.:| ::||          .::||...:....:|:||||||.: :.::   :
  Fly   171 PRYL-------QYNTLKSISLERCDELIGWGVQSELCLIHEADNGACNGDSGGPAV-YNNQ---V 224

  Fly   384 EGIVSFGYK-CGLKDWPGVYTNVAAYDIWIRQN 415
            .|:..|.:. || ..:|..|..|..::.||:.|
  Fly   225 VGVAGFVWSACG-TSYPDGYARVYYHNEWIKNN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 75/273 (27%)
Tryp_SPc 162..415 CDD:238113 76/275 (28%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/273 (27%)
Tryp_SPc 32..256 CDD:238113 76/275 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.