DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Ser7

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:451 Identity:143/451 - (31%)
Similarity:202/451 - (44%) Gaps:90/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAAVFLCILIAHEAKAQSDSRCL----NPNQTP---GLCVLINECQTLYSVLKRATLTDQEK 58
            |.:...:||.:|   .|:||...:.:    |.|...   |.|:...:|. .|:|.|...|..:::
  Fly     1 MLLLIPLFLTLL---GAEAQQFGKAIMHFGNCNSVEFGRGTCIEKKDCD-FYAVDKLMELASKQQ 61

  Fly    59 SFIKSSACGRGSNNQP-YVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPW 122
            .|         |..:| .|||.::|..:                       |.  :.||     .
  Fly    62 CF---------SRQRPDLVCCPRETNII-----------------------PP--LAPR-----I 87

  Fly   123 SFGNQPATSRT------PFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEY 181
            |.|...|||.|      |........|...||:.|.||. ....|:..|.:|.:.||||..||||
  Fly    88 SNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGS-AFSFRLVGGHNTGLFEFPWTTLLEY 151

  Fly   182 RRRSGNGLSTACAGSLINRRYVLTAAHCL--TGRIEREVGTLVSVRLGEHDTRTAVDCP---PGG 241
            ...|| |...||..|.|.:|::||||||:  .||      .|.:..|||.:..|..||.   .|.
  Fly   152 ETVSG-GKDYACGASFIAQRWLLTAAHCIHTMGR------NLTAAILGEWNRDTDPDCENDLNGV 209

  Fly   242 GSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRY--SDNIQPICLPSSVGLESRQ- 303
            ..|:|...|:..:.|..|.:|||  .|..:||.|:|:.|.|.:  ..|::|:|||...|..:.| 
  Fly   210 RECAPPHIRVTIDRILPHAQYSE--LNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQL 272

  Fly   304 SGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRF-SQIKVNLEPTQLCAGGQFRKDSCDG 367
            :|....|:|||:|.....|.:|||..::.....:|::.| ...|:.|..:|:||||:...|||.|
  Fly   273 AGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSG 337

  Fly   368 DSGGPLM---------RFRDESWVLEGIVSFGYK-CGLKDWPGVYTNVAAYDIWIRQNVRA 418
            ||||||.         |:    ..|.|:||.|.| ||...:.|:||.|::|..||...:||
  Fly   338 DSGGPLTVEANTASGNRY----VYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 13/60 (22%)
Tryp_SPc 161..412 CDD:214473 100/269 (37%)
Tryp_SPc 162..415 CDD:238113 101/271 (37%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/54 (24%)
Tryp_SPc 131..388 CDD:214473 100/269 (37%)
Tryp_SPc 133..391 CDD:238113 101/270 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25969
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.