DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG31827

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:282 Identity:77/282 - (27%)
Similarity:125/282 - (44%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CG-----GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTG 212
            ||     .|.::..:.:||.... ||||.:.:.:.|      |....||||....||||||.:  
  Fly    31 CGYGNPDAVKVQFNVTEGQAKPA-EFPWTIAVIHNR------SLVGGGSLITPDIVLTAAHRI-- 86

  Fly   213 RIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQ---VHDIG 274
             ..::|..:| |..||.:..:|::..|             |||..|.:....|:.|.   .:::.
  Fly    87 -FNKDVEDIV-VSAGEWEYGSALEKYP-------------FEEAFVLKMVIHKSFNYQRGANNLA 136

  Fly   275 LIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGR--TLKMARSAVKQKVTVNYVDPAK 337
            |:.::|....:..|..||||:.   :...|..:..|||||:  ........|.:|:.:..|....
  Fly   137 LLFLDREFPLTYKINTICLPTQ---KRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHI 198

  Fly   338 CRQRFSQIKVNLEPT----QLCAGGQFRKDSCDGDSGGPL---MRFRDESWVLEGIVSFGYKCGL 395
            |:.:..:.::....|    .:||||:...|:|.||.||.|   |....:.:...|||::|..|..
  Fly   199 CQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKE 263

  Fly   396 KDWPGVYTNVAAYDIWIRQNVR 417
            |:.|..||:|..:..||.|.::
  Fly   264 KNVPATYTDVFEFKPWIVQQIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 71/262 (27%)
Tryp_SPc 162..415 CDD:238113 73/264 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 71/259 (27%)
Tryp_SPc 50..280 CDD:214473 69/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.