DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG32523

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:273 Identity:61/273 - (22%)
Similarity:99/273 - (36%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 IRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLV 222
            |..||..|......:||..:.|..|...      .|.|.:|:..:|:||.||:....:.....|.
  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEH------YCGGVIISATHVITAGHCVKHGNDVVPADLW 91

  Fly   223 SVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDN 287
            |::.|..             ..|.:..|:...|:.:|..|:....|   |:.::|::..:.:..|
  Fly    92 SIQAGSL-------------LLSSDGVRIPVAEVIMHPNYATGGHN---DLAVLRLQSPLTFDAN 140

  Fly   288 IQPICL-----PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQK---------VTVNYVDPAKC 338
            |..|.|     |:.|.::         ::|||.        :.:|         |.|..:....|
  Fly   141 IAAIQLATEDPPNCVAVD---------ISGWGN--------IAEKGPLSDSLLFVQVTSISRGAC 188

  Fly   339 RQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVS--FGYKCGLKDWPGV 401
            |..|..   .|..|.:|........:|.||||||    ......:.|:.|  .|..|| :..|..
  Fly   189 RWMFYS---RLPETMICLLHSKNSGACYGDSGGP----ATYGGKVVGLASLLLGGGCG-RAAPDG 245

  Fly   402 YTNVAAYDIWIRQ 414
            |..::....||.:
  Fly   246 YLRISKVRAWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 58/266 (22%)
Tryp_SPc 162..415 CDD:238113 59/269 (22%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/266 (22%)
Tryp_SPc 37..219 CDD:238113 48/223 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.