DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG32376

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:334 Identity:89/334 - (26%)
Similarity:152/334 - (45%) Gaps:65/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YGAFGGDWEEERPQSFVFPRQERRP-WS------------FGNQPATSRTP-FRKSSTSDGSSLL 147
            |..||.:.|          .:||.| ||            :|.....:.|| |...|::...:.|
  Fly     2 YQNFGSESE----------GRERDPSWSGYYKDNGTHYLLYGKPEDIAPTPNFGNISSNPFINAL 56

  Fly   148 PQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTG 212
            ....|     ...||.:|:.....|.|:...|.|..      ...|...:||:.::|||.||..|
  Fly    57 EAQES-----FPTRIVNGKRIPCTEAPFQGSLHYEG------YFVCGCVIINKIWILTAHHCFFG 110

  Fly   213 RIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIR 277
            ..|:     .:||:|....|.       ||... .|:::  ..:..:..|:.:     ||:.:::
  Fly   111 PPEK-----YTVRVGSDQQRR-------GGQLR-HVKKI--VALAAYNDYTMR-----HDLAMMK 155

  Fly   278 MERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVK--QKVTVNYVDPAKCRQ 340
            ::..|.:...::|:.|||:   ::.:..::|.|:|||.|...|::..:  ::|.::|:..:||::
  Fly   156 LKSPVYFGKCVRPVKLPST---KTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQK 217

  Fly   341 RFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNV 405
            .:.:..:.:....:|| .:..||||.|||||||    ....||.||||:|..|..|::||||.|.
  Fly   218 MYKKAGLKIYKDMICA-SRTNKDSCSGDSGGPL----TSRGVLYGIVSWGIGCANKNYPGVYVNC 277

  Fly   406 AAYDIWIRQ 414
            ..|..||::
  Fly   278 KRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 71/252 (28%)
Tryp_SPc 162..415 CDD:238113 72/255 (28%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 71/252 (28%)
Tryp_SPc 66..287 CDD:238113 72/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.