DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG32260

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:424 Identity:126/424 - (29%)
Similarity:172/424 - (40%) Gaps:77/424 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CLNPNQTPGLCVLINECQTLYSVLKRATLTDQEKSFIKSSACGRGSNNQPYVCCTQDTGYVRIQR 89
            |.:....||.|:.:..|..|....:..  .::..:|:..|.||...:.....|.|..:|..| .|
  Fly   194 CQDARSRPGSCLPLTSCPQLMQEYQGQ--ANEFHTFLGQSICGFDGSTFMVCCATDRSGNAR-SR 255

  Fly    90 QD---RTFPDYGAF------GGDWEEERPQSFVFPRQERRPWSFGNQPATSRTPFRKSSTSDGSS 145
            :|   .|...:|.|      ||              ....|..|...|..|:..        ..|
  Fly   256 KDVFVTTAAPFGFFHFSPLSGG--------------STATPMVFQPTPPLSQVV--------SPS 298

  Fly   146 LLPQPP------------SCGGVG-IRNRIYDGQDTDVNEFPWMVLLEY-RRRSGNGLSTACAGS 196
            ..|.||            :||..| ..||:..|.:.....:||:..|.| ...:.|.|...|.||
  Fly   299 FYPPPPPPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGS 363

  Fly   197 LINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHER 261
            ||:.|||:|:|||:.       ..|..||||.||    :..|...|:....::|     ..|||.
  Fly   364 LIHSRYVITSAHCIN-------PMLTLVRLGAHD----LSQPAESGAMDLRIRR-----TVVHEH 412

  Fly   262 YS-EKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVG-LESRQSGQQFTVAGWGRTLKM-ARSA 323
            :. ...||   ||.||.:........||.|||||.:.. ::....|....|||||..... ..|.
  Fly   413 FDLNSISN---DIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQ 474

  Fly   324 VKQKVTVNYVDPAKCRQRFSQI--KVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDES----WV 382
            |.:...|..|....|.|.:..|  .|......||||.. ..|:|.||||||||..:.|.    :.
  Fly   475 VLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSS-SVDACQGDSGGPLMMPQLEGNVYRFY 538

  Fly   383 LEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |.|:|||||:|...::|||||.||:|..||::::
  Fly   539 LLGLVSFGYECARPNFPGVYTRVASYVPWIKKHI 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855 10/52 (19%)
Tryp_SPc 161..412 CDD:214473 91/260 (35%)
Tryp_SPc 162..415 CDD:238113 92/262 (35%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855 10/51 (20%)
Tryp_SPc 327..568 CDD:214473 91/260 (35%)
Tryp_SPc 328..571 CDD:238113 92/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.