DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:295 Identity:89/295 - (30%)
Similarity:124/295 - (42%) Gaps:62/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GSSLLPQPPSCGGVGIR---NRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVL 204
            |..||...|.||...:.   :||..|.......:||...|..::      ...|.|||::..:||
  Rat     8 GFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQK------VHVCGGSLLSPEWVL 66

  Fly   205 TAAHCLTGRI-----EREVGTLVSVRLGEHDTR-------TAVDCPPGGGSCSPEVQRLGFEEIR 257
            |||||.:|.:     |..:|.| ::.|..|.:.       ::...|||...              
  Rat    67 TAAHCFSGSVNSSDYEVHLGEL-TITLSPHFSTVKQIIMYSSAPGPPGSSG-------------- 116

  Fly   258 VHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRT-----L 317
                          ||.|:::...|..|..:||:|||.:..  ....|.|..|.|||.|     |
  Rat   117 --------------DIALVQLATPVALSSQVQPVCLPEASA--DFHPGMQCWVTGWGYTQEGEPL 165

  Fly   318 KMARSAVKQKVTVNYVDPAKCRQRFSQIKVNL-EPTQLCAGGQFRKDSCDGDSGGPLMRFRDESW 381
            |...:..:.||:|  ||...|.|.:|....:| :...|||.|.  .|:|..||||||:......|
  Rat   166 KPPYNLQEAKVSV--VDVETCSQAYSSSNGSLIQSDMLCAWGP--GDACQDDSGGPLVCRVAGIW 226

  Fly   382 VLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ...|:||:|..||..|.||||..|.||..||.:::
  Rat   227 QQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 81/268 (30%)
Tryp_SPc 162..415 CDD:238113 82/270 (30%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 81/268 (30%)
Tryp_SPc 30..260 CDD:238113 82/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.