DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:290 Identity:81/290 - (27%)
Similarity:122/290 - (42%) Gaps:84/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRL 226
            |..|::...:::||.|.|.::   .:.....|.||||:.::|||||||:...|:           
  Rat    30 IVGGREASESKWPWQVSLRFK---FSFWMHFCGGSLIHPQWVLTAAHCVGLHIK----------- 80

  Fly   227 GEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKAS-------NQVH----------DIG 274
                              |||:.|     :::.|:|...|.       ..||          ||.
  Rat    81 ------------------SPELFR-----VQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIA 122

  Fly   275 LIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWG-----------RTLKMARSAVKQKV 328
            |:.:|..|..|.:|.|..||.:  .|:..||....|.|||           ..||        :|
  Rat   123 LLELENPVNVSTHIHPTSLPPA--SETFPSGTSCWVTGWGDIDSDEPLLPPYPLK--------QV 177

  Fly   329 TVNYVDPAKCRQRF-------SQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGI 386
            .|..|:.:.|.:::       ..:.: ::...||||.. |.|||.|||||||:.....:|:..|:
  Rat   178 KVPIVENSLCDRKYHTGLYTGDDVPI-VQDGMLCAGNT-RSDSCQGDSGGPLVCKVKGTWLQAGV 240

  Fly   387 VSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ||:|..|...:.||:||.|..|..||.:.|
  Rat   241 VSWGEGCAEANRPGIYTRVTYYLDWIHRYV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 78/284 (27%)
Tryp_SPc 162..415 CDD:238113 80/287 (28%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 80/286 (28%)
Tryp_SPc 30..266 CDD:214473 78/284 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.