DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and f10

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:272 Identity:88/272 - (32%)
Similarity:138/272 - (50%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL 210
            :||...:.|.    .||.:|.:....:.||..||......|     .|.|:::...::|:||||:
Zfish   233 ILPVVSTAGD----GRIVNGVECPPGDCPWQALLINENNMG-----FCGGTILTEHFILSAAHCM 288

  Fly   211 TGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGL 275
            ...:.      :.|.:||:||..     |.|...:.:|     :||.:|:.|.....:  :||.|
Zfish   289 NESLS------IRVVVGEYDTLV-----PEGREATHDV-----DEILIHKNYQPDTYH--NDIAL 335

  Fly   276 IRMERNVRYSDNIQPICLPSSVGLESRQSGQQ--FTVAGWGRTLKMA-RSAVKQKVTVNYVDPAK 337
            |::.:.::::..|.|.||| .:....|...||  ..|:|:||..:.. .|.:.||:||.||:.||
Zfish   336 IKLSKPIKFTKYIIPACLP-EMKFAERVLMQQDDGLVSGFGRVREGGLSSTILQKLTVPYVNRAK 399

  Fly   338 CRQRFSQIKVNLEPTQLCAG-GQFRKDSCDGDSGGP-LMRFRDESWVLEGIVSFGYKCGLKDWPG 400
            |.:. |..|::  ....||| .|..||:|.|||||| :.||:: :|.:.|:||:|..|..|...|
Zfish   400 CIES-SNFKIS--GRMFCAGYDQEEKDACQGDSGGPHVTRFKN-TWFITGVVSWGEGCARKGKYG 460

  Fly   401 VYTNVAAYDIWI 412
            |||.|:.|.:||
Zfish   461 VYTQVSKYIMWI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 83/255 (33%)
Tryp_SPc 162..415 CDD:238113 84/256 (33%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 83/255 (33%)
Tryp_SPc 245..474 CDD:238113 84/256 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.