DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:319 Identity:94/319 - (29%)
Similarity:130/319 - (40%) Gaps:72/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 WSFGNQPATSRTPFRKS---STSDGSSLLPQPPSCGGVGIRN---RIYDGQDTDVNEFPWMVLLE 180
            |:......::|..:..|   |.|.||       .||...:.|   ||..|.......:||...|.
Mouse    48 WATSKPTVSARGQYPDSLANSVSSGS-------GCGHPQVSNSGSRIVGGHAAPAGTWPWQASLR 105

  Fly   181 YRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRI-----EREVGTLVSVRLGEHDTR-------T 233
            ..:      ...|.|||::..:|||||||.:|.:     :..:|.| :|.|..|.:.       |
Mouse   106 LHK------VHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGEL-TVTLSPHFSTVKRIIMYT 163

  Fly   234 AVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVG 298
            ....|||...                            ||.|:::...|..|..:||:|||.:..
Mouse   164 GSPGPPGSSG----------------------------DIALVQLSSPVALSSQVQPVCLPEASA 200

  Fly   299 LESRQSGQQFTVAGWGRT-----LKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNL-EPTQLCAG 357
              ....|.|..|.|||.|     ||...:..:.||:|  ||...|.|.::....:| :|..|||.
Mouse   201 --DFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSV--VDVKTCSQAYNSPNGSLIQPDMLCAR 261

  Fly   358 GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            |.  .|:|..||||||:.....:|...|:||:|..||..|.||||..|.||..||..::
Mouse   262 GP--GDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 82/268 (31%)
Tryp_SPc 162..415 CDD:238113 83/270 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 83/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.