DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Prss45

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:308 Identity:81/308 - (26%)
Similarity:125/308 - (40%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LLPQPPSCGGVGIRNRIYDGQDT--------------DVNEFPWMVLLEYRRRSGNGLSTACAGS 196
            |||..|:.|        |:...|              :.:.:||...|:...:.      .|.|:
Mouse    28 LLPPRPNLG--------YNENYTEPVCGTPWWPDNLEESHHWPWEASLQIEDKH------VCGGA 78

  Fly   197 LINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHER 261
            ||:|.:|::||||:.|..|      .||.||.....      |.|.|.:.::. :|  :|.:|.:
Mouse    79 LIDRSWVVSAAHCIQGNKE------YSVMLGSSTLH------PNGSSWTLKIP-VG--DIIIHPK 128

  Fly   262 YSEKASNQVH-DIGLIRMERNVRYSDNIQPICLPSSVGLESR---QSGQQFTVAGWGRTLKMARS 322
            |..:  |.:. ||.|:.:|..|.::..:||||||     |..   :.|.:..|.|||:       
Mouse   129 YWGR--NFIRSDIALLCLETPVTFNKYVQPICLP-----EHNFNFKVGTKCWVTGWGQ------- 179

  Fly   323 AVKQ-------------KVTVNYVDPAKC------RQRFSQIKVNLEPTQLCAGGQFRKDSCDGD 368
             |||             :..|..:|...|      :..:.|:...:....:|. ..:.:|.|.||
Mouse   180 -VKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICT-TNYGEDLCYGD 242

  Fly   369 SGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            .||||....|..|:|.|:.|:...|.......|||.:..|.|||:..|
Mouse   243 PGGPLACEIDGRWILAGVFSWEKACATVPNLSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/287 (25%)
Tryp_SPc 162..415 CDD:238113 75/289 (26%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 73/266 (27%)
Tryp_SPc 59..286 CDD:214473 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.