DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG30289

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:257 Identity:92/257 - (35%)
Similarity:134/257 - (52%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRL 226
            |:.|..|::.|.|||||:        ..|..|.||||.|::|||||||::...       :.|||
  Fly    42 IFGGAKTNIQENPWMVLV--------WSSKPCGGSLIARQFVLTAAHCVSFED-------LYVRL 91

  Fly   227 GEHDTRTAVDCPPG--GGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQ 289
            |:::|   :|..|.  ...|.|:...:..:...|||.|:  .....:||.|:||...|.|||.::
  Fly    92 GDYET---LDPMPYCLNNHCIPKFYNISVDMKIVHENYN--GITLQNDIALLRMSEAVEYSDYVR 151

  Fly   290 PICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQL 354
            ||||  .|| |..||...|||.|||.|.....|.:....|:..:|.:.|..:|::   ..:.:|:
  Fly   152 PICL--LVG-EQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNK---QADRSQI 210

  Fly   355 CAGGQFRKDSCDGDSGGPL-MRFRDESWVLE---GIVSFGYKCGLKDWPGVYTNVAAYDIWI 412
            |||.. ..::|.||||||| .:|...:.:|.   |:||:|.:....:..||||||:.:..||
  Fly   211 CAGSH-TSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 90/255 (35%)
Tryp_SPc 162..415 CDD:238113 92/257 (36%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 90/255 (35%)
Tryp_SPc 42..271 CDD:238113 90/255 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.