DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG30287

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:291 Identity:98/291 - (33%)
Similarity:141/291 - (48%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QP----PSCGGVGIRN-----RIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVL 204
            ||    |.|  |..|:     |:.:|:..|:...||||::..|     |: ..|.||||..||||
  Fly    22 QPHLLDPQC--VTARSEPGLYRVINGKPADLFSNPWMVIIIER-----GM-MKCGGSLITPRYVL 78

  Fly   205 TAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQ 269
            |||||     :.|..:.::||||::|...||||...|  |.|..:.:......|...|:....| 
  Fly    79 TAAHC-----KSETKSQLTVRLGDYDVNQAVDCSSYG--CIPRPREINVTRTYVPSHYTNFRKN- 135

  Fly   270 VHDIGLIRMERNVRYSDNIQPICL-------PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQK 327
              ||.|:|:|..|:|.|||:.|||       .|::    .::..:|...|||||.....|.|.|:
  Fly   136 --DIALLRLETTVQYGDNIRSICLLMGDYTWSSNI----LKNLVKFNTTGWGRTESRINSPVLQQ 194

  Fly   328 VTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPL-MRFR---DESWVLEGIVS 388
            .::.:...:.|.|.|.:   .|:.:.:|.... ...:|.||||||| .|.|   :...:|.|:||
  Fly   195 ASLTHHHLSYCAQVFGK---QLDKSHICVASS-TGSTCQGDSGGPLTARVRIGSERRVILFGVVS 255

  Fly   389 FG-YKC-GLKDWPGVYTNVAAYDIWIRQNVR 417
            :| ..| |    |.|||||..:..||..:.:
  Fly   256 YGAVHCFG----PTVYTNVIHFANWIELHTK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 90/263 (34%)
Tryp_SPc 162..415 CDD:238113 91/265 (34%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/263 (34%)
Tryp_SPc 42..280 CDD:238113 91/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.