DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG30088

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:99/275 - (36%)
Similarity:133/275 - (48%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PSCG---GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTG 212
            ||||   ...:..||..|::..:...|:|..|.|      .....|.|::|:.||:||||||:. 
  Fly    31 PSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYY------SSEIHCGGTIISSRYILTAAHCMR- 88

  Fly   213 RIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIR 277
                   ..:.|||||||.....||.  ||||||..:.........::|:....:|   ||.|::
  Fly    89 -------PYLKVRLGEHDITRNPDCQ--GGSCSPPAEEFDIVLATKYKRFDRFLAN---DIALLK 141

  Fly   278 MERNVRYSDNIQPICL---PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCR 339
            :.||:|::.:||||||   |::.     .:..:|...|||:|.....:.|.|...:...|...||
  Fly   142 LSRNIRFNVHIQPICLILNPAAA-----PNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCR 201

  Fly   340 QRFSQ-IKVNLEPTQLCAGGQFRKDSCDGDSGGPLMR--FRDESW--VLEGIVSFG-YKCGLKDW 398
            ...|. |.:|    |||.|.| ..|:|.|||||||:.  ..|..|  :..|||||| .||   ..
  Fly   202 SVLSMPITIN----QLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC---QS 258

  Fly   399 PGVYTNVAAYDIWIR 413
            |||||.|..|..|||
  Fly   259 PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 92/259 (36%)
Tryp_SPc 162..415 CDD:238113 94/261 (36%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 92/259 (36%)
Tryp_SPc 45..273 CDD:238113 92/259 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.