DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and TPSD1

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:236 Identity:66/236 - (27%)
Similarity:101/236 - (42%) Gaps:38/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIE 215
            |:.|....:..|..||:...:::||.|.|..|   |......|.||||:.::|||||||    :|
Human    27 PAPGQALQQTGIVGGQEAPRSKWPWQVSLRVR---GPYWMHFCGGSLIHPQWVLTAAHC----VE 84

  Fly   216 REVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMER 280
            .::..|.::|:...:.....           :.|.|....|.||.::....:..  ||.|:.:|.
Human    85 PDIKDLAALRVQLREQHLYY-----------QDQLLPVSRIIVHPQFYIIQTGA--DIALLELEE 136

  Fly   281 NVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWG---RTLKMARSAVKQKVTVNYVDPAKCRQRF 342
            .|..|.:|..:.||.:  .|:...|....|.|||   ..:.:......::|.|..|:...|...:
Human   137 PVNISSHIHTVTLPPA--SETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEY 199

  Fly   343 S---------QIKVNLEPTQLCAGGQFRKDSCDGDSGGPLM 374
            .         ||   :....||||.: ..|||.|||||||:
Human   200 HTGLHTGHSFQI---VRDDMLCAGSE-NHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 64/226 (28%)
Tryp_SPc 162..415 CDD:238113 64/225 (28%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 64/225 (28%)
Tryp_SPc 38..240 CDD:214473 64/225 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.