DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:298 Identity:83/298 - (27%)
Similarity:118/298 - (39%) Gaps:77/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PQPPS--CGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL 210
            |:|.:  .|.||       |.:...:::||.|.|.::.   |.....|.||||:.::|||||||:
Mouse    23 PRPANQRVGIVG-------GHEASESKWPWQVSLRFKL---NYWIHFCGGSLIHPQWVLTAAHCV 77

  Fly   211 TGRIEREVGTLVSVRLGEH-----DTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQV 270
            ...|:..  .|..|:|.|.     |                  |.|....|.||..|....... 
Mouse    78 GPHIKSP--QLFRVQLREQYLYYGD------------------QLLSLNRIVVHPHYYTAEGGA- 121

  Fly   271 HDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDP 335
             |:.|:.:|..|..|.::.||.||.:  .|:...|....|.|||              .::..:|
Mouse   122 -DVALLELEVPVNVSTHLHPISLPPA--SETFPPGTSCWVTGWG--------------DIDNDEP 169

  Fly   336 AKCRQRFSQIKVNLEPTQLC----------------------AGGQFRKDSCDGDSGGPLMRFRD 378
            ........|:||.:....||                      ..|..|:|||.|||||||:....
Mouse   170 LPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVK 234

  Fly   379 ESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            .:|:..|:||:|..|...:.||:||.|..|..||.:.|
Mouse   235 GTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 75/277 (27%)
Tryp_SPc 162..415 CDD:238113 77/279 (28%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/285 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.