DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and CG12256

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:126/268 - (47%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 RNRIYDGQDTDVNEF-PWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLV 222
            :.|:..|.|...:|: |:.|.:::..|||. :...|.||||....|||||||:.|:....:..:.
  Fly    44 QERVVGGYDVPEDEYVPYQVSMQFLTRSGK-MRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVA 107

  Fly   223 SVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSD- 286
            .:|          |.....|..| :||     ...::|.|.|..::   ||.:::::......: 
  Fly   108 GIR----------DLNDSSGFRS-QVQ-----SYEMNENYQELVTS---DIAILKIDPPFELDEK 153

  Fly   287 NIQPICLPSS--VGLESRQSGQQFTVAGWGRTLKMARS------AVKQKVTVNYVDPAKCRQRFS 343
            .:..|.:..|  ||.:     |:..:.|||........      .|.||:....:..:||::..:
  Fly   154 RVSTIDVSGSDMVGAD-----QEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT 213

  Fly   344 QIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAY 408
            |    |..|::||..:|.|.:|:|||||||:....||:...|:||:|......:.|.|||.|:.:
  Fly   214 Q----LTDTEICALERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMF 274

  Fly   409 DIWIRQNV 416
            |.||::.:
  Fly   275 DGWIKERM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/260 (28%)
Tryp_SPc 162..415 CDD:238113 74/262 (28%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/260 (28%)
Tryp_SPc 47..280 CDD:238113 74/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.