DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Prss29

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:287 Identity:89/287 - (31%)
Similarity:137/287 - (47%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIE 215
            |:.|..|:...|..|......::||.|.|...|.........|.||:|:.::|||||||:.   |
Mouse    20 PAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIR---E 81

  Fly   216 REVG-TLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVH-----DIG 274
            |:.. ::..:|:||....        ||.     :.|....:.:|..:       ||     |:.
Mouse    82 RDADPSVFRIRVGEAYLY--------GGK-----ELLSVSRVIIHPDF-------VHAGLGSDVA 126

  Fly   275 LIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFT--VAGWGRTLKMARSAVK----QKVTVNYV 333
            |:::..:|:...|::|:.|||    ||.:..::..  |.||| .:...||...    |:|.|..:
Mouse   127 LLQLAVSVQSFPNVKPVKLPS----ESLEVTKKDVCWVTGWG-AVSTHRSLPPPYRLQQVQVKII 186

  Fly   334 DPAKCRQRFSQI--------KVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFG 390
            |.:.|.:.:...        |:.|: ..||||.| .:|||.|||||||:.....||.|.|:||:|
Mouse   187 DNSLCEEMYHNATRHRNRGQKLILK-DMLCAGNQ-GQDSCYGDSGGPLVCNVTGSWTLVGVVSWG 249

  Fly   391 YKCGLKDWPGVYTNVAAYDIWIRQNVR 417
            |.|.|:|:||||..|.::..||.|.::
Mouse   250 YGCALRDFPGVYARVQSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 83/270 (31%)
Tryp_SPc 162..415 CDD:238113 85/272 (31%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 85/272 (31%)
Tryp_SPc 31..271 CDD:214473 83/269 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.