DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Prss28

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:273 Identity:69/273 - (25%)
Similarity:119/273 - (43%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGR-----IER-EVGT 220
            |..||.|...::||.|.|.......|.....|.||:|:.:::||||||:..:     :.| :||.
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE 95

  Fly   221 LVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYS 285
            :...:                     |.:.|....|.:|..|::.:..  .|:.|:::...:..|
Mouse    96 VYLYK---------------------EQELLNISRIIIHPDYNDVSKR--FDLALMQLTALLVTS 137

  Fly   286 DNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVK-----QKVTVNYVDPAKCRQRFSQI 345
            .|:.|:.||..  ..:..|..|..:.|||..|:  |..::     .:|.:...|...|::.:.:.
Mouse   138 TNVSPVSLPKD--SSTFDSTDQCWLVGWGNLLQ--RVPLQPPYQLHEVKIPIQDNKSCKRAYRKK 198

  Fly   346 K------VNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTN 404
            .      |.:....||||...| ..|.|||||||:.::...|:..|:||.|..|. .:.|.:::.
Mouse   199 SSDEHKAVAIFDDMLCAGTSGR-GPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCS-NNLPSIFSR 261

  Fly   405 VAAYDIWIRQNVR 417
            |.:...||.|:::
Mouse   262 VQSSLAWIHQHIQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 66/266 (25%)
Tryp_SPc 162..415 CDD:238113 68/269 (25%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 68/269 (25%)
Tryp_SPc 31..269 CDD:214473 66/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.