DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:320 Identity:93/320 - (29%)
Similarity:137/320 - (42%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NQPATS------RTPFRKSSTSD--------GSSLLPQPPS--CGGVGIR--NRIYDGQDTDVNE 172
            |.|.||      |..||..::|:        .|..|..|.:  ||.:.:.  |....||::....
Zfish   254 NLPYTSNVNVKGRWVFRVDNSSEVKGSCINTNSQALDSPSAAVCGIIPVNSSNGTVGGQNSSAVH 318

  Fly   173 FPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDC 237
            :||...|.:  .||.    .|.|||||:.:||:||||..|   :..|..::|.||          
Zfish   319 WPWQASLYW--YSGQ----TCGGSLINKEWVLSAAHCFNG---QRNGFYLTVILG---------- 364

  Fly   238 PPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESR 302
            |.......|.......:.:..|..|:...::  :||.|:|:...:.::|:|:|:||.:       
Zfish   365 PKTQNKYDPSRISRSVKAVIKHPYYNPNTND--NDIALVRLSFPITFTDSIRPVCLAA------- 420

  Fly   303 QSGQQFT--VAGWGRTLKMARSAVK-------QKVTVNYVDPAKCRQRF--SQIKVNLEPTQLCA 356
             .|..|.  ...|..|.:.....|.       |:|.|..:...:|...:  ..|..|:    :||
Zfish   421 -EGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNM----ICA 480

  Fly   357 G----GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWI 412
            |    |   ||.|.||||||::..:...||..||||||..|...::|||||.|:.|..||
Zfish   481 GLLKEG---KDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 77/265 (29%)
Tryp_SPc 162..415 CDD:238113 79/266 (30%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 7/17 (41%)
Tryp_SPc 309..537 CDD:238113 77/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.