DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and Tpsab1

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:288 Identity:84/288 - (29%)
Similarity:126/288 - (43%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAH 208
            |||:...|  |....|..|..||:...|::||.|.|   |.:.......|.||||:.::||||||
Mouse    13 SSLVHAAP--GPAMTREGIVGGQEAHGNKWPWQVSL---RANDTYWMHFCGGSLIHPQWVLTAAH 72

  Fly   209 CLTGRIEREVGTLVSVR---LGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERY---SEKAS 267
            |:...:.......|.:|   |..||....|                  .:|..|..:   .:.| 
Mouse    73 CVGPDVADPNKVRVQLRKQYLYYHDHLMTV------------------SQIITHPDFYIVQDGA- 118

  Fly   268 NQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRT---LKMARSAVKQKVT 329
                ||.|:::...|..||.:.|:.||.:  .|:..||....|.|||..   :.:......::|.
Mouse   119 ----DIALLKLTNPVNISDYVHPVPLPPA--SETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQ 177

  Fly   330 VNYVDPAKCRQRFSQIKVN------LEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVS 388
            |..::...|..::.:..:.      :....||||.: ..|||.|||||||:...:::|:..|:||
Mouse   178 VPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAGNE-GHDSCQGDSGGPLVCKVEDTWLQAGVVS 241

  Fly   389 FGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            :|..|...:.||:||.|..|..||...|
Mouse   242 WGEGCAQPNRPGIYTRVTYYLDWIHHYV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 75/265 (28%)
Tryp_SPc 162..415 CDD:238113 77/267 (29%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 76/265 (29%)
Tryp_SPc 29..265 CDD:214473 75/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.