DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and proc.2

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:323 Identity:95/323 - (29%)
Similarity:139/323 - (43%) Gaps:57/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 WSFGNQPATSRTPFRKSS--------------TSDGSSLLPQPPSCGGVGIRN--------RIYD 164
            |..|:.|...:.|..|:|              |....|:..:......|...:        ||..
 Frog   374 WGQGDDPTAEKKPINKTSLDHNEIGASVRAARTGTSKSVWEENHGLASVEPDDYNTPDGDVRIVG 438

  Fly   165 GQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEH 229
            |...::.:.||.||:  |...|.|.   |.||||:.|:||:||||...:|...      |.:|::
 Frog   439 GMRCELGQCPWQVLI--RNNRGFGF---CGGSLISSRWVLSAAHCFESQIPHH------VTIGDY 492

  Fly   230 DT-RTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICL 293
            || |..:|           .|::...::..|..|  .|....|||.|:.:.....:.:..:||||
 Frog   493 DTYRRDMD-----------EQKIAVLQVFSHPNY--LAEFYDHDIALLFLRSPAMFGEYSRPICL 544

  Fly   294 PS-SVGLESRQSGQQFTVAGWGRTLKM---ARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQL 354
            |: .:|....|.||...|:|||.|.:.   .|..:|.::.:  |....|......|   |.....
 Frog   545 PNPGLGKMLTQEGQTGQVSGWGATRQFGPYTRFLLKVRLPI--VSQETCMASTENI---LTGNMF 604

  Fly   355 CAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416
            ||| .:..||:|.||||||......::|.|.|:||:|..|..|...||||.||.|..||::.:
 Frog   605 CAGYKEGVKDACSGDSGGPFAVLFHDTWFLVGVVSWGDGCAEKGKYGVYTRVANYMPWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 84/256 (33%)
Tryp_SPc 162..415 CDD:238113 85/258 (33%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 85/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.