DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and zgc:165423

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:292 Identity:93/292 - (31%)
Similarity:131/292 - (44%) Gaps:47/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SDGSSLLP--QPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYV 203
            |.|....|  .||:||...:..:|..|.:.....:||...|   ..||   |..|.||||:.:::
Zfish    15 STGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASL---HESG---SHFCGGSLISDQWI 73

  Fly   204 LTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASN 268
            |:||||..........|   |.||    |.:.|.|      :|........::.||..|  :.|.
Zfish    74 LSAAHCFPSNPNPSDYT---VYLG----RQSQDLP------NPNEVSKSVSQVIVHPLY--QGST 123

  Fly   269 QVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQF-----TVAGWGRT---LKMARSAVK 325
            ..:|:.|:.:...|.:|:.|||:||.:        .|..|     .:.|||..   :.:....:.
Zfish   124 HDNDMALLHLSSPVTFSNYIQPVCLAA--------DGSTFYNDTMWITGWGTIESGVSLPSPQIL 180

  Fly   326 QKVTVNYVDPAKCRQRF---SQIKVNLEPTQLCAG-GQFRKDSCDGDSGGPLMRFRDESWVLEGI 386
            |:|.|..|....|...:   |.|..|:    :||| .|..||||.||||||::.....:||..|:
Zfish   181 QEVNVPIVGNNLCNCLYGGGSSITNNM----MCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGV 241

  Fly   387 VSFGYKCGLKDWPGVYTNVAAYDIWIRQNVRA 418
            ||||..|...::||||..|:.|..||.|.|||
Zfish   242 VSFGKGCADPNYPGVYARVSQYQNWISQYVRA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 80/262 (31%)
Tryp_SPc 162..415 CDD:238113 82/264 (31%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 80/262 (31%)
Tryp_SPc 38..269 CDD:238113 82/263 (31%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.