DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and zgc:163079

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:281 Identity:81/281 - (28%)
Similarity:119/281 - (42%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLT 211
            |.|...||...:..:|..|.:.....:||...:..:...    ...|.|||||:.:|||.|    
Zfish    21 LGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATE----EFYCGGSLINKGWVLTTA---- 77

  Fly   212 GRIEREVGTL-----VSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVH 271
                 :|..|     :.|.||....         .||...|:.|...:.|: |..|:...||   
Zfish    78 -----KVFALMPASDIVVYLGRQTQ---------NGSNPYEISRTVTKIIK-HPNYNSLDSN--- 124

  Fly   272 DIGLIRMERNVRYSDNIQPICLPS--SVGLESRQSGQQFTVAGWGRTLKMAR------SAVKQKV 328
             :.|:::...|.:||.|:|:||.:  ||.::    |....|.|||...:.|.      ..|.|:|
Zfish   125 -LALLKLSSPVTFSDYIKPVCLAAAGSVFVD----GTASWVTGWGYLNRPATVEEIMLPDVLQEV 184

  Fly   329 TVNYVDPAKCRQRFSQIKVNLEPTQLCAG--GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGY 391
            ....|:..:|...:..|..|   ..||||  .:..|..|.||.||||:..:...|:..|:|..||
Zfish   185 EAPIVNNFECNAAYGGIITN---KLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGY 246

  Fly   392 KCGLKDWPGVYTNVAAYDIWI 412
             |||..:|.:|..|:.|:.||
Zfish   247 -CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 75/265 (28%)
Tryp_SPc 162..415 CDD:238113 77/266 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 75/265 (28%)
Tryp_SPc 36..267 CDD:238113 77/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.