DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9733 and LOC100004427

DIOPT Version :9

Sequence 1:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:278 Identity:80/278 - (28%)
Similarity:126/278 - (45%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTA---CAGSLINRRYVLTAAH 208
            |.|...||...:..:|..|.:.....:||...:.::       ||.   |:||||:.|:|||||.
Zfish    21 LGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFK-------STGQFFCSGSLISERWVLTAAS 78

  Fly   209 CLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDI 273
            |    .:|...:.|.:.||...|         .||...|:.|... ::.|.|           ||
Zfish    79 C----FQRINVSDVVIYLGRLTT---------NGSNPYEIPRTVI-QVSVTE-----------DI 118

  Fly   274 GLIRMERNVRYSDNIQPICLPS--SVGLESRQSGQQFTVAGWGRT--LKMARSAVKQKVTVNYVD 334
            .|:::..:|.::|.|:|:||.:  ||.::    |.:..|.|||.|  ..:..|.:.::|....|:
Zfish   119 ALVQLSSSVTFTDYIRPVCLAAAGSVFVD----GTESWVTGWGSTSSTNVILSDMLKEVEAPIVN 179

  Fly   335 PAKCRQRFSQIK--VNLEPTQLCAG--GQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGL 395
            ..:|    |.|.  .||: ..:|||  .:..|..|..|.|.||:..:...|:..|:|.|.: ||.
Zfish   180 NIEC----SNINGITNLD-NVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVFTF-CGQ 238

  Fly   396 KDWPGVYTNVAAYDIWIR 413
            ..:|.:|..|:.|:.|||
Zfish   239 NGFPTLYARVSEYEEWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/261 (28%)
Tryp_SPc 162..415 CDD:238113 76/263 (29%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 73/261 (28%)
Tryp_SPc 36..257 CDD:238113 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.