DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and gzmk

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:244 Identity:66/244 - (27%)
Similarity:103/244 - (42%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 CSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEK 240
            |.|.||..:.:||:|.|            |.|.:....|..        ..||.:..:..|....
Zfish    62 CGGILIHKQWVLTSAQC------------KEVPVSSVTVLI--------GSLSLSKGSQRIGILN 106

  Fly   241 IHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFN 305
            ..:...:.|  ..|.:||.:|||...|....:.:|     |:|. .:..|....|.|||.||   
Zfish   107 YEIPKTFNE--KTKEDDIMLIRLSKKVKAKPYKIP-----KNEK-DVPPGTKCVVRGWGTTD--- 160

  Fly   306 KYFINIHSPIKLK-LRIPYVSNENCTKILEGFGVRLGPKQICAGG-EFAKDTCAGDSGGPLMYFD 368
              :.:..:..||: |.:..|..:.|.:......| :....:|||. :..:.||.|||||||    
Zfish   161 --YKDEQASDKLQMLEVLVVDRDQCNRYYNRNPV-ITKDMLCAGNTQQHRGTCWGDSGGPL---- 218

  Fly   369 RQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAE-YTDWIDSVVQQRKKS 416
              ..:....||:| |...||:..||.|||.::: :..||:|:::|:..|
Zfish   219 --ECKKNLVGVIS-GSQGCGIPKKPTVYTFLSKRHISWINSILRQQFNS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 61/232 (26%)
Tryp_SPc 150..409 CDD:238113 63/235 (27%)
gzmkXP_017208551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.