DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and zgc:123295

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:279 Identity:94/279 - (33%)
Similarity:132/279 - (47%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LNECGKQVTN-RIYGGEIAELDEFPWLALLVYNSNDYG---CSGALIDDRHILTAAHCVQGEGVR 199
            ||.||:...| :|.||:.|....:||...|  .|..||   |.|:||:...:|:||||.|     
Zfish    24 LNVCGRAPLNTKIVGGQNAGAGSWPWQVSL--QSPTYGGHFCGGSLINKDWVLSAAHCFQ----- 81

  Fly   200 DRQGLKHVRLG-EFNVKTEPDCIEEPNYLSCADAALDIAYEKIHV--HPEYKEFSNYKYNDIAII 261
            |..|...|:|| :....:.|               ..|....:.|  ||.|...||  .||||::
Zfish    82 DSIGTIMVKLGLQSQSGSNP---------------YQITKTVVQVINHPNYNNPSN--DNDIALV 129

  Fly   262 RLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSN 326
            :|...|:|..::.|:||.....  |.|.|.:..|:|||:.    ....|....|..::.||.||:
Zfish   130 KLDSSVTFNDYIEPVCLAAAGN--TYAAGTLSWVTGWGKL----SSAANQIPDILQEVEIPIVSH 188

  Fly   327 ENCTKILEGFGVRLGPKQICAG--GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGM 389
            .:|.:...|   .:....||||  .:..||:|.||||||::  .|..|:|:..|:||:| ..|..
Zfish   189 SDCKRAYPG---EITSNMICAGLLDQGGKDSCQGDSGGPMV--SRNGSQWIQSGIVSFG-RGCAE 247

  Fly   390 AGKPAVYTNVAEYTDWIDS 408
            .|.|.||..|::|.|||.|
Zfish   248 PGYPGVYARVSQYQDWITS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 86/264 (33%)
Tryp_SPc 150..409 CDD:238113 89/267 (33%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 86/264 (33%)
Tryp_SPc 36..264 CDD:238113 86/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.