DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG34171

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:110/255 - (43%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCA------ 230
            :::.|:|.::.:||:||:|||     :.|:.|          |...|..|.   ...||      
  Fly    53 DNHFCTGVILTNRHVLTSAHC-----ITDKNG----------VMMSPKRIV---VALCASLFKTP 99

  Fly   231 ---DAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT-HFVMPICLPNKSEPLTLAEGQ 291
               :..:||  ..:.:||.|   ...::||||||:||..|... |.:.|:.|.|.|    |..|.
  Fly   100 ESEEFVVDI--HNMIIHPYY---HRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSS----LEVGN 155

  Fly   292 MFSVSGWGRTDLFNKYFINIHSPIKLKLRI-PYVSNENCTKILEGFGVRLGPKQ---ICAGGEFA 352
            .....| |...:..:.|.:.||.:.:.:.: |:   :.|.|:.:.. :...|:.   ||.... .
  Fly   156 DCKTIG-GIFGVRRQRFGSFHSMLLVNVELRPF---DECLKVKKSL-MAARPENEDLICVKST-E 214

  Fly   353 KDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQ 412
            |..|..|.|||| :.|.|     .|| ::.|...|. :..|..:::|:.|..|:..::.:
  Fly   215 KQMCTTDFGGPL-FCDGQ-----LYG-IALGSINCS-SPDPVFFSDVSFYNSWVTKIISE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 64/247 (26%)
Tryp_SPc 150..409 CDD:238113 65/250 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 64/247 (26%)
Tryp_SPc 38..263 CDD:304450 65/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.