DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9737 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:	NP_651783.1	Gene:	CG9737 / 43600	FlyBaseID:	FBgn0039758	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	XP_021326346.1	Gene:	si:dkeyp-93a5.2 / 571079	ZFINID:	ZDB-GENE-131127-18	Length:	130	Species:	Danio rerio

Alignment Length:	142	Identity:	46/142 - (32%)
Similarity:	64/142 - (45%)	Gaps:	39/142 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   272 FVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGF 336
            ||.|:   |.|.|.||.:                             ..:|.|.|.:|..:|
Zfish     4 FVFPV---NLSHPRTLQQ-----------------------------TVVPVVINSDCNNLL--- 33

  Fly   337 GVRLGPKQICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVA 400
            |..:....:||| .:..||||.||||||::  .:|.|.||..|::|.|. .||...:|.|||.|:
Zfish    34 GATITDNMMCAGLLQGGKDTCQGDSGGPMV--SQQCSVWVQSGIISKGH-DCGQPYEPGVYTRVS 95

  Fly   401 EYTDWIDSVVQQ 412
            :|.:||.|.:.|
Zfish    96 QYQNWIMSSINQ 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9737	NP_651783.1	CLIP	28..89	CDD:288855
		Tryp_SPc	149..406	CDD:214473	42/134 (31%)
		Tryp_SPc	150..409	CDD:238113	44/137 (32%)
si:dkeyp-93a5.2	XP_021326346.1	Tryp_SPc	<9..103	CDD:238113	41/128 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X11
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910